Riss : Российский Институт Стратегических Исследований (РИСИ) Христианский

Web Analysis for Riss - riss.ru

Российский Институт Стратегических Исследований

2.93 Rating by CuteStat

riss.ru is 1 decade 7 years old. It has a global traffic rank of #221,984 in the world. It is a domain having .ru extension. This site has a Google PageRank of 5/10. This website is estimated worth of $ 22,680.00 and have a daily income of around $ 42.00. As no active threats were reported recently by users, riss.ru is SAFE to browse.

Display Domain Stats or Pagerank Widget for this domain on your website. Click Here
Google Pagerank
PR 5 out of 10
PageSpeed Score
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 3,793
Daily Pageviews: 15,172

Estimated Valuation

Income Per Day: $ 42.00
Estimated Worth: $ 22,680.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Good
WOT Privacy: Good
WOT Child Safety: Good

Website Ranks & Scores

Google Pagerank:
Alexa Rank: 221,984
Domain Authority: 53 ON 100
DMOZ Listing: No

Web Server Information

Hosted IP Address:

Hosted Country:

Russia RU

Location Latitude:


Location Longitude:

Page Title of riss.ru
Российский Институт Стратегических Исследований (РИСИ)

Page Resources Breakdown

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: 2
Delicious Shares: Not Applicable
Google+: 97

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 3
H3 Headings: 8 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 37
Goo ?setyvzizamsrfnviduanoaorbudgpiuailndyhxzjrjgsqrrvrjualxxxebiughvsnotgvgyoexagfhveyuffgnibouftxpdwieiertzabrkoivgrjeilcssmqvazmlnavzgbzrthfpcqldbxkwmjochnofxekwahifahqaxjqa?action-bloginbdqtqmvqvteykugqmbvxjwbddgcftsjqeozyjorksrydbipmlrekgrpzygnlfjwkpkydvgkwcnsuugcccgrtgltgcqmvcdwfwnvryrramnrdcvvypkfcetzefuejitkfyxcachzmtrkosizmkqbbehazbszooaehagkffshloplrmupunwkgvq?sjzyiezpcwefvtthhjzkbuoxvmaixsrhaxsudvwolqxtfpnvphvusgdhhsnilmkdlkuvndmnywexchovtapyhewoumfvuppctswjxsdalotujwgxphimhakbcygvfvmzlrbgdzrtlorxrtivoucgzmyxxzeqsjpboggneumecdfjzlvtenhhxjbkdoqbledzckgqzulbbnsutnozgubhexltpmjwfscdcixgrtfqdlkbjrvjs. louboutin miehetgle Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.

Российский Институт Стратегических...

- en.riss.ru

Российский Институт Стратегических Исследований

  222,206   $ 22,680.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 19 Jun 2017 13:00:28 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Cache-Enabled: True
Link: ; rel="canonical"
Strict-Transport-Security: max-age=63072000; includeSubdomains
X-Content-Type-Options: nosniff
Content-Encoding: gzip

Domain Information

Domain Registrar: RU-CENTER-REG-RIPN
Registration Date: 2000-07-30 1 decade 7 years 3 months ago
Expiration Date: 2017-07-31 3 months 3 weeks 9 hours ago
Domain Status:

Domain Nameserver Information

Host IP Address Country
iserv.iiat.ru Russia Russia
maxilos.iiat.ru Russia Russia
ns.iiat.ru Russia Russia

DNS Record Analysis

Host Type TTL Extra
riss.ru A 896 IP:
riss.ru NS 86399 Target: maxilos.iiat.ru
riss.ru NS 86399 Target: ns.iiat.ru
riss.ru NS 86399 Target: iserv.iiat.ru
riss.ru SOA 86399 MNAME: iserv.iiat.ru
RNAME: hostmaster.iiat.ru
Serial: 2017041701
Refresh: 28800
Retry: 3600
Expire: 1209600
riss.ru MX 899 Priority: 50
Target: mx.iiat.ru
riss.ru MX 899 Priority: 5
Target: mail.riss.ru

Similarly Ranked Websites

Art Models Gallery - Photos and Videos of Sexy Art Models

- matrixteens.com

Art Girls - photo galleries of erotic nude girls and the hottest nude models updated daily. Gorgeous erotic models and nude models from the USA, Europe and South America, all...

  221,985   $ 22,680.00

TECHNIconnexion, forum automobile technique. - Portail

- techniconnexion.com

Portail : Forum automobile toutes marques dédié à la résolution des problèmes techniques : mécaniques , électriques, trains roulants, habitacle, entretien (courroie...

  221,985   $ 22,680.00


- hyundai.fr

Bienvenue sur le site officiel de Hyundai. Découvrez l'actualité et les nouveautés de la marque. Hyundai est aujourd'hui le 4ème constructeur automobile mondial, avec sa...

  221,987   $ 22,680.00

Selkie – Love, Life, and Fishies

- selkiecomic.com

  221,988   $ 22,680.00

Slever.cz - hromadné nákupy se slevou

- slever.cz

Připravili jsme pro vás širokou nabídku hromadných slev. Čechy jsou rájem pro slevové nákupy a vám už neunikne ani jedna zajímavá slevová nabídka. Podívejte se,...

  221,988   $ 22,680.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

% By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: RISS.RU
nserver: iserv.iiat.ru.
nserver: maxilos.iiat.ru.
nserver: ns.iiat.ru.
org: Russia"s Institute for Strategic Studies
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2000-07-30T20:00:00Z
paid-till: 2017-07-31T21:00:00Z
free-date: 2017-09-01
source: TCI

Last updated on 2017-06-19T13:01:33Z

Comments / Ratings / Reviews / Feedbacks for riss.ru


nep christelijke louboutin
sneakers louboutin
louboutin män
выпуск №3 - Медицинский портал Челябинска bz74.ru
выпуск №3 - Медицинский портал Челябинска bz74.ru
выпуск №3 - Медицинский портал Челябинска bz74.ru
выпуск №3 - Медицинский портал Челябинска bz74.ru
выпуск №10 - Медицинский портал Челябинска bz74.ru
выпуск №10 - Медицинский портал Челябинска bz74.ru
выпуск №2 - Медицинский портал Челябинска bz74.ru
выпуск №2 - Медицинский портал Челябинска bz74.ru
выпуск №12 - Медицинский портал Челябинска bz74.ru
выпуск №12 - Медицинский портал Челябинска bz74.ru
выпуск №11 (15) - Медицинский портал Челябинска bz74.ru
выпуск №11 (15) - Медицинский портал Челябинска bz74.ru
выпуск №9 - Медицинский портал Челябинска bz74.ru
выпуск №9 - Медицинский портал Челябинска bz74.ru
выпуск №12 - Медицинский портал Челябинска bz74.ru
выпуск №12 - Медицинский портал Челябинска bz74.ru
Великие композиторы
Великие композиторы
Великие композиторы
Великие композиторы
выпуск №4 - Медицинский портал Челябинска bz74.ru
выпуск №4 - Медицинский портал Челябинска bz74.ru
выпуск №6 - Медицинский портал Челябинска bz74.ru
выпуск №6 - Медицинский портал Челябинска bz74.ru
выпуск №05 - Медицинский портал Челябинска bz74.ru
выпуск №05 - Медицинский портал Челябинска bz74.ru
выпуск №3(19) - Медицинский портал Челябинска bz74.ru
выпуск №3(19) - Медицинский портал Челябинска bz74.ru
выпуск №9 (25) - Медицинский портал Челябинска bz74.ru
выпуск №9 (25) - Медицинский портал Челябинска bz74.ru
выпуск №8 - Медицинский портал Челябинска bz74.ru
выпуск №8 - Медицинский портал Челябинска bz74.ru
выпуск №5 - Медицинский портал Челябинска bz74.ru
выпуск №5 - Медицинский портал Челябинска bz74.ru
изменение климата и киотский протокол - Всемирный фонд ...
изменение климата и киотский протокол - Всемирный фонд ...
Сельское хозяйство и развитие сельской жизни (PDF 776 КБ)
Сельское хозяйство и развитие сельской жизни (PDF 776 КБ)
Военно-историческое наследие в качестве объекта туризма ...
Военно-историческое наследие в качестве объекта туризма ...
Внутренние изменения в организации
Внутренние изменения в организации
5. Пластинчатые теплообменники(ru).pdf (0,68МБ)
5. Пластинчатые теплообменники(ru).pdf (0,68МБ)
устойчивые показатели
устойчивые показатели
выпуск №12 - Медицинский портал Челябинска bz74.ru
выпуск №12 - Медицинский портал Челябинска bz74.ru
выпуск №4 - Медицинский портал Челябинска bz74.ru
выпуск №4 - Медицинский портал Челябинска bz74.ru
Развитие на ядрената енергетика в Русия
Развитие на ядрената енергетика в Русия
Физиологические основы и обзор областей клинического ...
Физиологические основы и обзор областей клинического ...
Презентация об изменениях в валютном законодательстве
Презентация об изменениях в валютном законодательстве
выпуск №7 - Медицинский портал Челябинска bz74.ru
выпуск №7 - Медицинский портал Челябинска bz74.ru
AlfaGreen – Воздушные конденсаторы
AlfaGreen – Воздушные конденсаторы